Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 5
HMGB2 Antibody (PA5-95367) in ICC/IF
Immunocytochemistry analysis of HMGB2 using anti-HMGB2 antibody (Product # PA5-95367) . HMGB2 was detected in a section of U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-HMGB2 antibody (Product # PA5-95367) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. V... View More
Product Details
PA5-95367
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human HMGB2 (65-97aa KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807170
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
HMGB2 encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: High mobility group protein 2; High mobility group protein B2; high-mobility group (nonhistone chromosomal) protein 2; high-mobility group box 2; HMG 2; HMG B2; HMG-2; HMG-B2; HMGB-2
Gene Aliases: C80539; HMG-2; HMG2; HMGB2
UniProt ID: (Human) P26583, (Rat) P52925, (Mouse) P30681
Entrez Gene ID: (Human) 3148, (Rat) 29395, (Mouse) 97165
four-way junction DNA binding
enhancer sequence-specific DNA binding
DNA binding
damaged DNA binding
double-stranded DNA binding
single-stranded DNA binding
transcription factor activity, sequence-specific DNA binding
protein binding
transcription factor binding
drug binding
DNA binding, bending
protein domain specific binding
chemoattractant activity
transcription regulatory region DNA binding
non-sequence-specific DNA binding, bending
poly(A) RNA binding
RAGE receptor binding
supercoiled DNA binding
lipid binding
nucleosomal histone binding
chromatin binding
positive regulation of endothelial cell proliferation
base-excision repair, DNA ligation
chromatin remodeling
regulation of transcription from RNA polymerase II promoter
spermatogenesis
spermatid nucleus differentiation
nervous system development
male gonad development
organ regeneration
positive regulation of nuclease activity
positive regulation of DNA binding
positive regulation of erythrocyte differentiation
positive regulation of megakaryocyte differentiation
negative regulation of transcription, DNA-templated
positive regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
response to steroid hormone
positive chemotaxis
positive regulation of DNA metabolic process
cell chemotaxis
cellular response to lipopolysaccharide
negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
inflammatory response to antigenic stimulus
DNA topological change
apoptotic DNA fragmentation
chromatin organization
nucleosome assembly
transcription, DNA-templated
DNA geometric change
response to lipopolysaccharide
positive regulation of interferon-beta production
V(D)J recombination
response to drug
innate immune response
positive regulation of innate immune response
regulation of neurogenesis
defense response to Gram-negative bacterium
defense response to Gram-positive bacterium
DNA ligation involved in DNA repair
regulation of stem cell proliferation
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support