Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
MA5-16079
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse
Host/Isotype
Mouse
/ IgG1
Class
Monoclonal
Type
Antibody
Clone
IU5C1
Immunogen
A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein.
Conjugate
Form
Liquid
Concentration
1.0 mg/mL
Purification
Protein G
Storage buffer
PBS
Contains
0.1% sodium azide
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_11155852
Product Specific Information
The target sequence has 96% sequence homology with rat, primate, and feline, 88% sequence homology with chicken, 87% sequence homology with bovine, 72% sequence homology with drosophila melanogaster.
Suggested positive control: 293 transfected lysate.
Target Information
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutathione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternative splicing by exon deletion results in several splice variants but maintains the original open reading frame in all forms.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ATP-binding cassette sub-family C member 1; ATP-binding cassette transporter variant ABCC1delta-ex13; ATP-binding cassette transporter variant ABCC1delta-ex13&14; ATP-binding cassette transporter variant ABCC1delta-ex25; ATP-binding cassette transporter variant ABCC1delta-ex25&26; ATP-binding cassette, sub-family C (CFTR/MRP), member 1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1a; ATP-binding cassette, sub-family C (CFTR/MRP), member 1b; DKFZp686N04233; DKFZp781G125; Glutathione-S-conjugate-translocating ATPase ABCC1; leuk; Leukotriene C(4) transporter; LTC4 transporter; Multidrug resistance-associated protein 1; multiple drug resistance-associated protein
Gene Aliases: ABC29; ABCC; ABCC1; Abcc1a; Abcc1b; GS-X; Mdrap; MRP; MRP1
UniProt ID: (Human) P33527, (Mouse) O35379
Entrez Gene ID: (Human) 4363, (Mouse) 17250
transporter activity
ATP binding
cobalamin-transporting ATPase activity
ATPase activity
ATPase activity, coupled to transmembrane movement of substances
anion transmembrane-transporting ATPase activity
nucleotide binding
long-chain fatty acid transporter activity
xenobiotic-transporting ATPase activity
drug transmembrane transporter activity
glutathione S-conjugate-exporting ATPase activity
efflux transmembrane transporter activity
hydrolase activity
lipid-transporting ATPase activity
glutathione transmembrane transporter activity
sphingolipid transporter activity
ATP-binding cassette (ABC) transporter
leukotriene metabolic process
transport
cobalamin metabolic process
cobalamin transport
vitamin transmembrane transport
response to drug
transmembrane transport
anion transmembrane transport
drug transmembrane transport
response to oxidative stress
plasma membrane long-chain fatty acid transport
positive regulation of cell migration
phospholipid efflux
glutathione transmembrane transport
xenobiotic transport
daunorubicin transport
drug export
cell chemotaxis
negative regulation of neuron death
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support