Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
PA5-69509
Product Specifications
Species Reactivity
Fruit fly
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
synthetic peptide corresponding to a region of fruit fly hb
Conjugate
Form
Liquid
Concentration
0.5-1.0 mg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 2% sucrose
Contains
0.09% sodium azide
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
RRID
AB_2689369
Product Specific Information
This target displays homology in the following species: Rat: 100%
Peptide sequence: MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration is batch dependent: 0.5-1 mg/mL
Target Information
Gap class segmentation protein that controls development of head structures.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CG9786-PA; CG9786-PB; hb-PA; hb-PB; LD14196p; Protein hunchback; Regulator-of-postbithorax
Gene Aliases: CG9786; Dmel\CG9786; Dmel_CG9786; HB; hbHLH; Hunchback; l(3)85Ah; R-pbx; Rg-bx; Rg-pbx
UniProt ID: (Fruit fly) P05084
Entrez Gene ID: (Fruit fly) 41032
RNA polymerase II core promoter proximal region sequence-specific DNA binding
RNA polymerase II transcription factor activity, sequence-specific DNA binding
transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
transcription factor activity, sequence-specific DNA binding
sequence-specific DNA binding
C2H2 zinc finger transcription factor
negative regulation of transcription from RNA polymerase II promoter
regulation of transcription from RNA polymerase II promoter
zygotic determination of anterior/posterior axis, embryo
neuroblast fate determination
ganglion mother cell fate determination
ventral cord development
salivary gland development
posterior head segmentation
trunk segmentation
regulation of development, heterochronic
regulation of transcription involved in anterior/posterior axis specification
positive regulation of transcription from RNA polymerase II promoter
generation of neurons
regulation of neurogenesis
regulation of neural precursor cell proliferation
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support