Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-99380
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
RLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQADF
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
PAI1 (plasminogen activator inhibitor 1) belongs to serine protease inhibitor superfamily, and is the principal inhibitor of tissue-type and urokinase-type plasminogen activators (tPA and uPA). Platelets are the main source of the circulating PAI11, but it is synthesized and secreted by many tissue and cell types, including fibroblasts, smooth muscle cells, endothelial cells, hepatocytes, and inflammatory cells. Expression of PAI11 can be regulated at the transcriptional level by many factors including growth factors, cytokines, hormones, inflammatory factors, glucose or lipid metabolites, vascular tone regulating factors, chemicals, and other environmental or physical factors. PAI1 is present at increased levels in various disease states, and has been linked to an increased occurrence of thrombosis in obesity, thrombophilia and the metabolic syndrome. Defects in PAI-1 are characterized by abnormal bleeding. PAI1 mediates inhibition of fibrinolysis by inhibiting the activity of plasminogen activator, and may promote neuronal survival. Other defects in PAI1 are the cause of plasminogen activator inhibitor-1 deficiency (PAI-1 deficiency). Alternatively spliced transcript variants encoding different isoforms of PAI1 have been found.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Endothelial plasminogen activator inhibitor; PAI; plas; Plasminogen activator inhibitor 1; serine (or cysteine) proteinase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1; Serpin E1; serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1; SERPINE-1
Gene Aliases: PAI; PAI-1; PAI1; PLANH1; SERPINE1
UniProt ID: (Human) P05121
Entrez Gene ID: (Human) 5054
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support