Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 3
Bcl-X Antibody (PA5-95348) in WB
Western blot analysis of BCL2L1 in Lane 1: SW620 whole cell lysates. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with BCL2L1 polyclonal antibody (Product # PA5-95348) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution of 1:10,000, and developed with enhanced chemiluminescence (ECL).
Product Details
PA5-95348
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X (75-105aa LDAREVIPMAAVKQALREAGDEFELRYRRAF).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807151
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded the BCL-X gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform acts as an apoptotic inhibitor and the shorter isoform acts as an apoptotic activator.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Apoptosis regulator Bcl-X; Bcl 2 like 1; bcl x; Bcl xL; BCL XL/S; bcl-2 L1; Bcl-2-like protein 1; bcl-xS; Bcl2-L-1; BCL2-like 1; BclxL; BclXS; DKFZp781P2092; protein phosphatase 1, regulatory subunit 52; RP5-857M17.3
Gene Aliases: Bcl-X; BCL-XL/S; BCL2L; BCL2L1; BCLX; PPP1R52
UniProt ID: (Human) Q07817
Entrez Gene ID: (Human) 598
cytokinesis
ovarian follicle development
in utero embryonic development
release of cytochrome c from mitochondria
endocytosis
mitotic cell cycle checkpoint
germ cell development
spermatogenesis
cell proliferation
positive regulation of cell proliferation
male gonad development
intrinsic apoptotic signaling pathway in response to DNA damage
apoptotic mitochondrial changes
fertilization
suppression by virus of host apoptotic process
response to cytokine
growth
negative regulation of apoptotic process
negative regulation of neuron apoptotic process
response to cycloheximide
regulation of mitochondrial membrane permeability
neuron apoptotic process
regulation of mitochondrial membrane potential
cellular process regulating host cell cycle in response to virus
mitochondrion morphogenesis
cellular response to amino acid stimulus
cellular response to alkaloid
cellular response to gamma radiation
apoptotic process in bone marrow
negative regulation of establishment of protein localization to plasma membrane
negative regulation of release of cytochrome c from mitochondria
extrinsic apoptotic signaling pathway in absence of ligand
hepatocyte apoptotic process
negative regulation of execution phase of apoptosis
negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
negative regulation of intrinsic apoptotic signaling pathway
positive regulation of intrinsic apoptotic signaling pathway
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support