Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 2
Calcitonin Antibody (PA5-95529) in IHC (P)
Immunohistochemistry analysis of Calcitonin in paraffin-embedded mouse brain tissue. Antigen retrieval was performed on the tissue using citrate buffer (pH 6, 20 min) and blocked with 10% goat serum. Samples were incubated with Calcitonin polyclonal antibody (Product # PA5-95529) at a 2 µg/mL dilution, followed by biotinylated goat anti-rabbit IgG (30 min, 37°C), and developed with Strepavidin-Biotin-Comple... View More
Product Details
PA5-95529
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of mouse Calcitonin (CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping conditions
Wet ice
RRID
AB_2807331
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Calcitonin is a 32 amino acid peptide which can be demonstrated in C cells of the normal and hyperplastic thyroid. Staining for calcitonin may be used for the identification of a spectrum of C cell proliferative abnormalities ranging from C cell hyperplasia to invasive tumors. Staining for calcitonin in medullary carcinoma of the thyroid produces a fine granular pattern in the cytoplasm. Amyloid deposits within the tumor may also exhibit varying degrees of calcitonin activity.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Alpha CGRP; Alpha type CGRP; Alpha-type CGRP; Calcitonin; calcitonin 1; calcitonin gene related peptide 1; Calcitonin gene-related peptide 1; Calcitonin gene-related peptide I; calcitonin-related polypeptide alpha; calcitonin/calcitonin-related polypeptide, alpha; CGRP-I; katacalcin; katacalcin (KC)
Gene Aliases: CA; Cal1; CAL6; Calc; CALC1; CALCA; calcitonin; CGRP; CGRP-1; CGRP-I; CGRP1; CT; Ctn; KC; PCT; RATCAL6
UniProt ID: (Human) P01258, (Rat) P01257, (Mouse) P70160
Entrez Gene ID: (Human) 796, (Rat) 24241, (Mouse) 12310
vasodilation of artery involved in baroreceptor response to increased systemic arterial blood pressure
regulation of heart rate
monocyte chemotaxis
inflammatory response
adenylate cyclase-activating G-protein coupled receptor signaling pathway
activation of adenylate cyclase activity
positive regulation of cytosolic calcium ion concentration
neuropeptide signaling pathway
embryo implantation
aging
feeding behavior
response to heat
negative regulation of ossification
negative regulation of neurological system process
activation of protein kinase activity
cellular protein metabolic process
positive regulation of adenylate cyclase activity
positive regulation of ossification
negative regulation of bone resorption
negative regulation of transcription, DNA-templated
negative regulation of smooth muscle contraction
response to pain
detection of temperature stimulus involved in sensory perception of pain
positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway
cellular response to tumor necrosis factor
cellular response to nerve growth factor stimulus
endothelial cell proliferation
vasculature development
neurological system process involved in regulation of systemic arterial blood pressure
G-protein coupled receptor internalization
protein phosphorylation
cellular calcium ion homeostasis
leukocyte cell-cell adhesion
neuromuscular junction development
regulation of heart contraction
regulation of blood pressure
negative regulation of calcium ion transport into cytosol
positive regulation of cAMP biosynthetic process
receptor internalization
positive regulation of interleukin-1 alpha production
positive regulation of interleukin-8 production
vasodilation
endothelial cell migration
positive regulation of macrophage differentiation
negative regulation of osteoclast differentiation
negative regulation of blood pressure
positive regulation of cell adhesion
positive regulation of vasodilation
regulation of cytosolic calcium ion concentration
sperm capacitation
mitophagy in response to mitochondrial depolarization
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support