Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
H00002253-M04
Product Specifications
Species Reactivity
Human
Host/Isotype
Mouse
/ IgG2a, kappa
Class
Monoclonal
Type
Antibody
Clone
3B10
Immunogen
FGF8 (NP_149354, 65 a.a. approximately 133 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Conjugate
Form
Liquid
Concentration
See Label
Purification
Affinity chromatography
Storage buffer
PBS, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Ambient (domestic); Wet ice (international)
Product Specific Information
Sequence of this protein is as follows: SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK
Target Information
Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Plays a role in neurite outgrowth in hippocampal cells.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: AIGF; androgen-induced; Androgen-induced growth factor; FGF; FGF-8; Fibroblast growth factor; Fibroblast growth factor 8; fibroblast growth factor 8 (androgen-induced); HBGF-8; Heparin-binding growth factor 8; MGC149376
Gene Aliases: AIGF; FGF-8; FGF8; HBGF-8; HH6; KAL6
UniProt ID: (Human) P55075
Entrez Gene ID: (Human) 2253
protein tyrosine kinase activity
Ras guanyl-nucleotide exchange factor activity
fibroblast growth factor receptor binding
growth factor activity
1-phosphatidylinositol-3-kinase activity
chemoattractant activity
phosphatidylinositol-4,5-bisphosphate 3-kinase activity
growth factor
intercellular signal molecule
MAPK cascade
patterning of blood vessels
metanephros development
branching involved in ureteric bud morphogenesis
organ induction
mesonephros development
neural plate morphogenesis
heart looping
blood vessel remodeling
outflow tract septum morphogenesis
epithelial to mesenchymal transition involved in endocardial cushion formation
apoptotic process
response to oxidative stress
gastrulation
motor neuron axon guidance
mesodermal cell migration
positive regulation of cell proliferation
gonad development
fibroblast growth factor receptor signaling pathway
anatomical structure morphogenesis
positive regulation of gene expression
regulation of phosphatidylinositol 3-kinase signaling
response to organic cyclic compound
peptidyl-tyrosine phosphorylation
pallium development
subpallium development
forebrain dorsal/ventral pattern formation
cell proliferation in forebrain
forebrain neuron development
signal transduction involved in regulation of gene expression
BMP signaling pathway
male genitalia development
thyroid gland development
otic vesicle formation
midbrain-hindbrain boundary development
dorsal/ventral axon guidance
embryonic hindlimb morphogenesis
aorta morphogenesis
phosphatidylinositol-3-phosphate biosynthetic process
odontogenesis
regulation of odontogenesis of dentin-containing tooth
response to drug
negative regulation of neuron apoptotic process
positive regulation of GTPase activity
cell fate commitment
positive regulation of mitotic nuclear division
positive regulation of organ growth
phosphatidylinositol phosphorylation
phosphatidylinositol-mediated signaling
forebrain morphogenesis
positive chemotaxis
positive regulation of cell division
negative regulation of cardiac muscle tissue development
pharyngeal system development
canonical Wnt signaling pathway
corticotropin hormone secreting cell differentiation
thyroid-stimulating hormone-secreting cell differentiation
bone development
lung morphogenesis
branching involved in salivary gland morphogenesis
neuroepithelial cell differentiation
positive regulation of ERK1 and ERK2 cascade
dopaminergic neuron differentiation
cell migration involved in mesendoderm migration
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support