Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Fetuin A Polyclonal Antibody
Advanced Verification
This Antibody was verified by Knockdown to ensure that the antibody binds to the antigen stated.
FIGURE: 1 / 7
Fetuin A Antibody (PA5-78744) in IHC (P)
Immunohistochemistry analysis of Fetuin A on paraffin-embedded human liver cancer tissue. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with Fetuin A polyclonal antibody (Product# PA5-78744) with a dilution of 1 µg/mL (overnight at 4°C), and followed by biotinylated goat anti-rabbit IgG (30 minutes at 37... View More
Product Details
PA5-78744
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Fetuin A (33-65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2745860
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 59 kDa bone sialic acid-containing protein; alpha 2 HS-glycoprotein alpha 2 (fetuin); Alpha-2-HS-glycoprotein; Alpha-2-Z-globulin; Ba-alpha-2-glycoprotein; BSP; fetuin A; Fetuin-A; FetuinA; Glycoprotein PP63; phosphorylated N-glycoprotein pp63
Gene Aliases: A2HS; Aa2-066; AHS; AHSG; FETUA; HSGA; pp63; PRO2743
UniProt ID: (Human) P02765, (Rat) P24090
Entrez Gene ID: (Human) 197, (Rat) 25373
skeletal system development
ossification
platelet degranulation
pinocytosis
acute-phase response
negative regulation of endopeptidase activity
regulation of bone mineralization
negative regulation of bone mineralization
negative regulation of phosphorylation
negative regulation of insulin receptor signaling pathway
regulation of inflammatory response
positive regulation of phagocytosis
negative regulation of biomineral tissue development
protein complex assembly
male gonad development
cerebral cortex development
negative regulation of cell growth
organ regeneration
cellular response to insulin stimulus
positive regulation of bone resorption
negative regulation of protein tyrosine kinase activity
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support