Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
HSD11B2 Polyclonal Antibody
Product Details
PA5-79399
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Published species
Rhesus monkey
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HSD11B2 (277-309aa EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2746515
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: -HSD11 type II; 11(beta)-HSD2; 11-beta-HSD type II; 11-beta-HSD2; 11-beta-hydroxysteroid dehydrogenase type 2; 11-beta-hydroxysteroid dehydrogenase type II; 11-DH2; 11-HSD type II; Corticosteroid 11-beta-dehydrogenase isozyme 2; hydroxysteroid (11-beta) dehydrogenase 2; Hydroxysteroid dehydrogenase, 11 beta type 2; NAD-dependent 11-beta-hydroxysteroid dehydrogenase; Short chain dehydrogenase/reductase family 9C member 3
Gene Aliases: 11HSD2; AME; AME1; HSD11B2; HSD11K; HSD2; SDR9C3
UniProt ID: (Human) P80365, (Mouse) P51661, (Rat) P50233
Entrez Gene ID: (Human) 3291, (Mouse) 15484, (Rat) 25117
11-beta-hydroxysteroid dehydrogenase [NAD(P)] activity
steroid binding
NAD binding
C-3 sterol dehydrogenase (C-4 sterol decarboxylase) activity
aldo-keto reductase (NADP) activity
isocitrate dehydrogenase activity
mevaldate reductase activity
gluconate dehydrogenase activity
steroid dehydrogenase activity
oxidoreductase activity
epoxide dehydrogenase activity
5-exo-hydroxycamphor dehydrogenase activity
2-hydroxytetrahydrofuran dehydrogenase activity
acetoin dehydrogenase activity
phenylcoumaran benzylic ether reductase activity
D-xylose:NADP reductase activity
L-arabinose:NADP reductase activity
D-arabinitol dehydrogenase, D-ribulose forming (NADP+) activity
steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
steroid dehydrogenase activity, acting on the CH-CH group of donors
(R)-(-)-1,2,3,4-tetrahydronaphthol dehydrogenase activity
3-hydroxymenthone dehydrogenase activity
very long-chain-3-hydroxyacyl-CoA dehydrogenase activity
dihydrotestosterone 17-beta-dehydrogenase activity
(R)-2-hydroxyisocaproate dehydrogenase activity
L-arabinose 1-dehydrogenase (NADP+) activity
L-xylulose reductase (NAD+) activity
3-ketoglucose-reductase activity
(R)-2-hydroxyglutarate dehydrogenase activity
D-arabinitol dehydrogenase, D-xylulose forming (NADP+) activity
dehydrogenase
oxidoreductase
metabolite interconversion enzyme
response to hypoxia
regulation of blood volume by renal aldosterone
glucocorticoid biosynthetic process
female pregnancy
response to food
response to insulin
response to drug
response to glucocorticoid
oxidation-reduction process
metabolic process
glucocorticoid metabolic process
response to steroid hormone
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support