Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 1
IFNAR1 Antibody (PA5-79441) in WB
Western blot analysis of IFNAR1/Beta R1 in, Lane 1: human K562 whole cell lysates, Lane 2: human T-47D whole cell lysates, Lane 3: human A549 whole cell lysates, Lane 4: mouse brain tissue lysates, Lane 5: mouse testis tissue lysates, Lane 6: mouse stomach tissue lysates, Lane 7: mouse lung tissue lysates, Lane 8: mouse HEPA1-6 whole cell lysates, Lane 9: mouse kidney tissue lysates. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with ... View More
Product Details
PA5-79441
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human IFNAR1 (263-306aa HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_2746557
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Interferons are widely used therapeutic agents because of their anti tumor and antiviral effects and because of their modulatory effects on the immune system (Biron,2001, Kirkwood, 2002). These cytokines produce their effects by binding to the Type 1 Interferon-& Receptor (IFNAR1). Down regulation of this receptor plays a key role in determining the magnitude and duration of cytokine signaling. This down regulation is thought to be influenced by phosphorylation of Serine 535 and 539 in the IFNAR1 (Kumar et al., 2003).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: alpha-type antiviral protein; beta-type antiviral protein; CRF2-1; Cytokine receptor class-II member 1; Cytokine receptor family 2 member 1; H3K1; IFN R1; IFN-alpha/beta receptor 1; IFN-alpha/betaR1; IFN-alpha/betaRalpha; IFN-R-1; IFNalpha/beta R1; IFNalpha/beta-Ralpha; IFNalpha/betaR1; IFNR1; interferon (alpha, beta and omega) receptor 1; Interferon alpha/beta receptor 1; interferon receptor 1; interferon-alpha/beta receptor alpha chain; interferon-beta receptor 1; Type I interferon receptor 1
Gene Aliases: AVP; IFN-alpha-REC; IFNAR; IFNAR1; IFNBR; IFRC
UniProt ID: (Human) P17181
Entrez Gene ID: (Human) 3454
JAK-STAT cascade
response to virus
response to lipopolysaccharide
positive regulation of interferon-beta production
positive regulation of interferon-gamma production
cellular response to interferon-alpha
T cell activation
type I interferon biosynthetic process
positive regulation of transcription, DNA-templated
positive regulation of interleukin-1 beta secretion
regulation of peptidyl-tyrosine phosphorylation
defense response to virus
type I interferon signaling pathway
regulation of type I interferon-mediated signaling pathway
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support