Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
Immunogen amino acids (97-199) contain the sequence MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE.
The interleukin 17 receptor E (IL-17RE) shares limited similarity to the receptor of IL-17A, a ubiquitous type I membrane glycoprotein that with IL-17A plays a pathogenic role in many inflammatory and autoimmune diseases such as rheumatoid arthritis. IL-17RE is the functional receptor of IL-17C and has been suggested to mediate mucosal immunity to infection with intestinal pathogens. IL-17C is produced by epithelia in response to bacterial challenge and binds to a receptor complex formed by IL-17RE and IL-17RA on the epithelial cell surface, thereby regulating the immune function of epithelial cells in an autocrine manner.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: IL-17 receptor E; Interleukin-17 receptor E
Gene Aliases: IL17RE; UNQ3056/PRO9877
UniProt ID: (Human) Q8NFR9
Entrez Gene ID: (Human) 132014
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support