Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
This target displays homology in the following species: Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Synthetic peptide located within the following region: TNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQ
This gene encodes a tissue-restricted nuclear transcriptional activator that is preferentially expressed in lymphoid tissue. Isolation of this protein initially defined a highly conserved LAF4/MLLT2 gene family of nuclear transcription factors that may function in lymphoid development and oncogenesis. In some ALL patients, this gene has been found fused to the gene for MLL. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: AF4/FMR2 family member 3; lymphoid nuclear protein 4; lymphoid nuclear protein related to AF4; protein LAF-4
Gene Aliases: 3222402O04Rik; A730046J16; LAF-4; Laf4
Entrez Gene ID: (Mouse) 16764
Molecular Function:
DNA-binding transcription factor
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support