Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 1
MICA Antibody (PA5-79671) in WB
Western blot analysis of MICA in, Lane 1: human Raji whole cell lysates, Lane 2: human SGC-7901 whole cell lysates, Lane 3: human SW620 whole cell lysates, Lane 4: human Jurkat whole cell lysates. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. After Electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. The membrane was blocked with 5% non-fat... View More
Product Details
PA5-79671
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human MICA (304-334aa QSHWQTFHVSAVAAAAKFVEIIFYVRCCKKK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.01mg sodium azide
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_2746786
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Major histocompatibility complex (MHC) class I proteins are ubiquitously expressed and mediate the recognition of intracellular antigens by cytotoxic T cells. A related family, termed the MHC class I chain-related (MIC) proteins are recognized by NKG2D, a receptor on NK and T cells, and promote anti-tumor activity. MICA, a member of the MIC family, is widely expressed on many tumors, and it is the MICA/NKG2D interaction that is thought to stimulate the anti-tumor reactivity by T lymphocytes. Both MICA and MICB mRNA are widely expressed in normal tissues, with MICA being present in virtually every tissue except the nervous system, suggesting that MIC protein expression may only be one component of the anti-tumor activity of the immune system.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: DAMA-345G11.2; HLA class I antigen; MHC class I chain-related protein A; MHC class I polypeptide-related sequence A; MHC class I related sequence A; MIC-A; MICA; stress inducible class I homolog; truncated MHC class I polypeptide-related sequence A
Gene Aliases: MIC-A; MICA; PERB11.1
UniProt ID: (Human) Q9TQA4
Entrez Gene ID: (Human) 100507436
T cell mediated cytotoxicity
immune response to tumor cell
cellular response to DNA damage stimulus
response to heat
cytolysis
antigen processing and presentation
negative regulation of natural killer cell activation
natural killer cell mediated cytotoxicity
defense response to bacterium
negative regulation of natural killer cell mediated cytotoxicity
gamma-delta T cell activation
regulation of immune response
defense response to virus
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support