Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 1
PMEL Antibody (PA5-95605) in WB
Western blot analysis of PMEL in Lane 1: rat heart tissue lysate, Lane 2: mouse heart tissue lysate. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with PMEL polyclonal antibody (Product # PA5-95605) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution of 1:10,000, and developed with enhanced chemiluminescence (ECL).
Product Details
PA5-95605
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human Melanoma gp100/PMEL (KVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLD).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping conditions
Wet ice
RRID
AB_2807407
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Melanoma is a malignant tumor of melanocytes which are found predominantly in skin but also in the bowel and the eye (see uveal melanoma). It is one of the rarer types of skin cancer but causes the majority of skin cancer related deaths.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 95kDa melanocyte-specific secreted glycoprotein; ME20-M; ME20M; Melanocyte lineage specific antigen GP100; melanocyte protein mel 17; Melanocyte protein PMEL; Melanocyte protein Pmel 17; Melanocytes lineage-specific antigen GP100; Melanoma-associated ME20 antigen; melanosomal matrix protein17; P1; P100; Pmel 17; Premelanosome protein; silver homolog; Silver locus protein; Silver locus protein homolog; silver, mouse, homolog of
Gene Aliases: D10H12S53E; D12S53E; D12S53Eh; gp100; gp87; ME20; ME20-M; ME20M; P1; P100; PMEL; PMEL17; SI; SIL; SILV
UniProt ID: (Human) P40967, (Mouse) Q60696
Entrez Gene ID: (Human) 6490, (Mouse) 20431, (Rat) 362818
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support