Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 1
PTGER4 Antibody (PA5-95439) in WB
Western blot analysis of PTGER4 in Lane 1: SW620 whole cell lysates, Lane 2: MCF-7 whole cell lysates. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with PTGER4 polyclonal antibody (Product # PA5-95439) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution of 1:10,000, and developed with enhanced chemiluminescence (ECL... View More
Product Details
PA5-95439
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PTGER4 (311-345aa DLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping conditions
Wet ice
RRID
AB_2807242
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2. This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 induced expression of early growth response 1, regulate the level and stability of cyclooxygenase-2 mRNA, and lead to the phosphorylation of glycogen synthase kinase-3. Knockout studies in mice suggest that this receptor may be involved in the neonatal adaptation of circulatory system, osteoporosis, as well as initiation of skin immune responses.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: EP1; MGC126583; PGE receptor EP4 subtype; PGE receptor, EP4 subtype; PGE2 receptor EP4 subtype; prostaglandin E receptor 4 (subtype EP4); Prostaglandin E2 receptor EP4 subtype; Prostanoid EP4 receptor
Gene Aliases: EP4; EP4R; PTGER2; PTGER4
UniProt ID: (Human) P35408
Entrez Gene ID: (Human) 5734
negative regulation of peptide secretion
immune response
adenylate cyclase-modulating G-protein coupled receptor signaling pathway
adenylate cyclase-activating G-protein coupled receptor signaling pathway
positive regulation of cytosolic calcium ion concentration
JNK cascade
female pregnancy
positive regulation of cell proliferation
response to mechanical stimulus
positive regulation of gene expression
negative regulation of hydrogen peroxide metabolic process
regulation of circadian sleep/wake cycle, wakefulness
positive regulation of smooth muscle cell migration
positive regulation of cAMP biosynthetic process
response to lipopolysaccharide
response to progesterone
positive regulation of interleukin-8 production
negative regulation of integrin activation
positive regulation of urine volume
positive regulation of renal sodium excretion
T-helper cell differentiation
negative regulation of circadian sleep/wake cycle, REM sleep
chemokinesis
response to drug
positive regulation of tyrosine phosphorylation of Stat3 protein
response to amino acid
positive regulation of osteoblast differentiation
positive regulation of bone resorption
positive regulation of cell adhesion
positive regulation of circadian sleep/wake cycle, non-REM sleep
negative regulation of cytokine secretion
negative regulation of interleukin-1 alpha secretion
positive regulation of cytokine secretion
negative regulation of inflammatory response
positive regulation of inflammatory response
regulation of stress fiber assembly
negative regulation of nitric-oxide synthase biosynthetic process
maternal process involved in parturition
bone development
positive regulation of mucus secretion
ERK1 and ERK2 cascade
cellular response to mechanical stimulus
cellular response to glucose stimulus
cellular response to interleukin-1
cellular response to prostaglandin E stimulus
positive regulation of wound healing
ductus arteriosus closure
positive regulation of hyaluronan biosynthetic process
response to salt
negative regulation of ductus arteriosus closure
negative regulation of small intestine smooth muscle contraction
positive regulation of calcitonin secretion
positive regulation of chemokinesis
positive regulation of matrix metallopeptidase secretion
negative regulation of tumor necrosis factor secretion
negative regulation of endothelin secretion
positive regulation of substance P secretion, neurotransmission
response to water-immersion restraint stress
positive regulation of antral ovarian follicle growth
positive regulation of neutrophil extravasation
negative regulation of eosinophil extravasation
positive regulation of interleukin-10 secretion
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support