Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 8
RAD51 Antibody (PA5-95579) in ICC/IF
Immunocytochemistry analysis of Rad51 using anti-Rad51 antibody (Product # PA5-95579) . Rad51 was detected in a section of U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-Rad51 antibody (Product # PA5-95579) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. V... View More
Product Details
PA5-95579
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human Rad51 (KKLEEAGFHTVEAVAYAPKKELINIKGISEAKADK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping conditions
Wet ice
RRID
AB_2807381
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
RAD51 plays a critical role in homologous strand exchange, a key step in DNA repair through homologous recobination. It binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. RAD51 catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template. It binds to a single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange. Mutations in the gene can results in breast cancer, mirror movements 2 and fanconi anemia.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: BRCA1/BRCA2-containing complex, subunit 5; DNA repair protein RAD51 homolog 1; HsRAD51; RAD51 homolog; RAD51 homolog A; RecA, E. coli, homolog of; RecA-like protein; recombination protein A
Gene Aliases: AV304093; BRCC5; FANCR; HRAD51; HsRad51; HsT16930; MRMV2; RAD51; RAD51A; RECA; RGD1563603
UniProt ID: (Human) Q06609, (Mouse) Q08297
Entrez Gene ID: (Human) 5888, (Mouse) 19361, (Rat) 499870
recombinase activity
four-way junction DNA binding
chromatin binding
double-stranded DNA binding
single-stranded DNA binding
endodeoxyribonuclease activity
protein binding
ATP binding
protein C-terminus binding
identical protein binding
single-stranded DNA-dependent ATPase activity
DNA polymerase binding
nucleotide binding
DNA binding
damaged DNA binding
DNA-dependent ATPase activity
molecular_function
DNA metabolism protein
telomere maintenance via recombination
double-strand break repair via homologous recombination
DNA recombinase assembly
DNA synthesis involved in DNA repair
strand displacement
regulation of protein phosphorylation
DNA unwinding involved in DNA replication
DNA repair
DNA recombination
mitotic recombination
cellular response to DNA damage stimulus
meiotic nuclear division
reciprocal meiotic recombination
response to toxic substance
response to X-ray
regulation of double-strand break repair via homologous recombination
telomere maintenance via telomere lengthening
replication fork processing
strand invasion
response to drug
positive regulation of DNA ligation
protein homooligomerization
chromosome organization involved in meiotic cell cycle
cellular response to ionizing radiation
cellular response to gamma radiation
cellular response to hydroxyurea
cellular response to cisplatin
cellular response to camptothecin
response to etoposide
replication-born double-strand break repair via sister chromatid exchange
mitotic recombination-dependent replication fork processing
DNA metabolic process
telomere organization
cellular response to alkaloid
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support