Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 3
SUR2A Antibody (MA5-45608) in ICC/IF
Immunocytochemistry/Immunofluorescence analysis using human neuroblastoma cells. Fixation involved 4% Formaldehyde for 15 min at RT. Samples were incubated with SUR2A monoclonal antibody (Product # MA5-45608) at 1:100 for 60 min at RT, followed by Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain used was Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1,000, 1:5,000 for 60 min RT, 5 min RT. Localization: Membrane. Magnification: 60X. (A) DAPI (blue) nuclear stain. (B) Phalloidin Texas Red F-Actin stain. (... View More
Product Details
MA5-45608
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Mouse
/ IgG2a
Class
Monoclonal
Type
Antibody
Clone
N319A/14
Immunogen
Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
Conjugate
Excitation/Emission Max
498/517 nm
View spectra
Form
Liquid
Concentration
1 mg/mL
Purification
Protein G
Storage buffer
9.09mM sodium bicarbonate/PBS, pH 7.4, with 640.91mM DMSO, 136.36mM ethanolamine
Contains
no preservative
Storage conditions
4° C, store in dark
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2932062
Product Specific Information
1 µg/mL of MA5-45608 was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.|Detects approximately 120kDa. Does not cross-react with SUR2B.
This antibody was formerly sold as clone S319A-14.
Target Information
Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ATP-binding cassette sub-family C member 9; ATP-binding cassette transporter sub-family C member 9; ATP-binding cassette, sub-family C (CFTR/MRP), member 9; FLJ36852; Sulfonylurea receptor 2; sulfonylurea-binding protein 2
Gene Aliases: ABC37; ABCC9; AI414027; AI449286; ATFB12; CANTU; CMD1O; SUR2; SUR2A; SUR2B
UniProt ID: (Human) O60706, (Rat) Q63563, (Mouse) P70170
Entrez Gene ID: (Human) 10060, (Rat) 25560, (Mouse) 20928
transporter activity
potassium channel activity
ATP binding
sulfonylurea receptor activity
potassium channel regulator activity
anion transmembrane-transporting ATPase activity
ion channel binding
drug binding
syntaxin binding
ATPase activity, coupled to transmembrane movement of substances
identical protein binding
nucleotide binding
ATPase activity
ATP-binding cassette (ABC) transporter
potassium ion transport
signal transduction
potassium ion import
defense response to virus
transmembrane transport
anion transmembrane transport
regulation of cardiac conduction
substrate-dependent cell migration, cell contraction
metabolic process
response to drug
potassium ion transmembrane transport
transport
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support