Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 1
TIMP3 Antibody (PA5-95446) in WB
Western blot analysis of TIMP3 in, Lane 1: rat kidney tissue lysates, Lane 2: NIH3T3 whole cell lysates. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50 µg of sample under reducing conditions. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. The membrane was blocked with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with TIMP3 Polyclonal Antibody (Pr... View More
Product Details
PA5-95446
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human TIMP3 (107-141aa RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping conditions
Wet ice
RRID
AB_2807249
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Tissue inhibitor of metalloproteinase 3 (TIMP3) is a member of the tissue inhibitor of metalloproteinases gene family. It functions to inhibit the activity of matrix metalloproteinases (MMP) which degrade components of the extracellular matrix. TIMP3 is expressed upon mitogenic stimulation. It binds irreversibly to zinc-dependent MMPs and inactivates them by binding to their catalytic zinc cofactor. Other functions of TIMP3 include nervous system development, tissue regeneration, and visual perception. In humans, the gene encoding TIMP3 is located on chromosome 22.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Metalloproteinase inhibitor 3; MIG-5 protein; Protein MIG-5; TIMP 3; TIMP-3; tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy, pseudoinflammatory); Tissue inhibitor of metalloproteinases 3
Gene Aliases: HSMRK222; K222; K222TA2; SFD; Sun; Timp-3; TIMP3
UniProt ID: (Human) P35625, (Mouse) P39876
Entrez Gene ID: (Human) 7078, (Rat) 25358, (Mouse) 21859
platelet degranulation
central nervous system development
aging
visual perception
response to mechanical stimulus
response to hormone
response to organic substance
tissue regeneration
response to amino acid
response to estrogen
negative regulation of membrane protein ectodomain proteolysis
response to folic acid
negative regulation of ERK1 and ERK2 cascade
cellular response to organic substance
positive regulation of TRAIL-activated apoptotic signaling pathway
negative regulation of metalloendopeptidase activity
negative regulation of endopeptidase activity
response to organic cyclic compound
response to cytokine
negative regulation of catalytic activity
negative regulation of proteolysis
negative regulation of peptidase activity
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support