Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Villin Polyclonal Antibody
Advanced Verification
This Antibody was verified by Relative expression to ensure that the antibody binds to the antigen stated.
FIGURE: 1 / 14
Villin Antibody (PA5-80221) in IHC (P)
Immunohistochemical analysis of Villin in paraffin-embedded section of mouse ileum organoid tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 5μg/mL rabbit anti-Villin antibody (Product # PA5-80221) overnight at 4°C. DyLight®488 Conjugated Goat A... View More
Product Details
PA5-80221
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2747335
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Villin is part of cytoskeleton associated with the microvillar actin core bundle of gastrointestinal and renal brush border. It can interact with actin in a Ca2+ and phosphoinositide-regulated manner. Villin is a very specific marker for adenocarcinomas of the gastrointestinal tract and the pancreas. It is also expressed in some Merkel cell tumor and adenocarcinoma of the lung, prostate, ovarian and kidney.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: OTTHUMP00000207159; Villin-1
Gene Aliases: D2S1471; VIL; VIL1
UniProt ID: (Human) P09327, (Mouse) Q62468
Entrez Gene ID: (Human) 7429, (Mouse) 22349, (Rat) 316521
calcium ion binding
protein binding
phosphatidylinositol-4,5-bisphosphate binding
lysophosphatidic acid binding
identical protein binding
protein homodimerization activity
cysteine-type endopeptidase inhibitor activity involved in apoptotic process
actin filament binding
actin binding
metal ion binding
molecular_function
non-motor actin binding protein
intestinal D-glucose absorption
protein complex assembly
apoptotic process
epidermal growth factor receptor signaling pathway
regulation of cell shape
response to bacterium
positive regulation of epithelial cell migration
actin filament polymerization
actin filament depolymerization
positive regulation of cell migration
positive regulation of actin filament depolymerization
epithelial cell differentiation
positive regulation of actin filament bundle assembly
regulation of microvillus length
cellular response to hepatocyte growth factor stimulus
positive regulation of multicellular organism growth
negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
actin nucleation
actin filament severing
barbed-end actin filament capping
regulation of actin nucleation
actin filament capping
cytoplasmic actin-based contraction involved in cell motility
regulation of wound healing
cellular response to epidermal growth factor stimulus
positive regulation of establishment of protein localization to plasma membrane
terminal web assembly
regulation of lamellipodium morphogenesis
positive regulation of lamellipodium morphogenesis
cytoskeleton organization
microvillus assembly
biological_process
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support