Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-95681
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
AXL is a chronic myelogenous leukemia-associated oncogene that is also associated with colon cancer and melanoma. The AXL protein is a receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding growth factors like vitamin K-dependent protein growth-arrest-specific gene 6, and is involved in the stimulation of cell proliferation. TAM receptors are also involved in phagocytosis of apoptotic cells. Mice lacking all three TAM receptors have several degenerative phenotypes linked to inefficient removal of apoptotic cells and membranes (e.g., in the retina and the male reproductive tract) and develop a severe autoimmune phenotype akin to systemic lupus erythematosus, including the production of broad spectrum auto-antibodies. In addition, Axl may function as a putative entry receptor for filoviruses. Axl is also used to identify a specific subpopulation of human blood dendritic cells, also referred to as Siglec 6+/Axl+ dendritic cells. Cellular expression of Axl can be upregulated by TLR ligands, such as LPS or poly I:C. Soluble Axl is generated by proteolytic cleavage of the membrane form. Increased plasma levels may be indicative of inflammation and cancer.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: AXL oncogene; AXL transforming sequence/gene; AZF1; oncogene AXL; sAXL; soluble AXL; Tyrosine-protein kinase receptor UFO
Gene Aliases: ARK; AXL; JTK11; Tyro7; UFO
UniProt ID: (Human) P30530
Entrez Gene ID: (Human) 558
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support