Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-107597
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84767. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
CCL19, also known as MIP-3 beta (Macrophage Inflammatory Protein 3 beta), is a member of the CC- subfamily of chemokines. It is most closely related to CCL21, with which it shares 32% amino acid sequence homology. CCL19 and CCL21 are expressed mainly by stromal cells in the T cell-rich zones of lymph nodes. They are critical mediators of the homeostatic trafficking of naive T cells and activated dendritic cells into the secondary lymphoid organs. CCL19 and CCL21 also play a role in T cell priming and activation, as well as the recruitment of lymphocytes to inflamed tissue. Both proteins signal via the G protein-coupled receptor, CCR7, which is expressed on T cells and mature dendritic cells. Although CCL19 and CCL21 both exhibit the same affinity for CCR7, only the binding of CCL19 results in the desensitization and internalization of the receptor.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: beta chemokine exodus-3; Beta-chemokine exodus-3; C-C motif chemokine; C-C motif chemokine 19; CC chemokine ligand 19; chemokine (C-C motif) ligand 19; CK beta-11; EBI1 ligand chemokine; EBI1-ligand chemokine; Epstein-Barr virus-induced molecule 1 ligand chemokine; exodus-3; M-MIP-3-beta; Macrophage inflammatory protein 3 beta; macrophage inflammatory protein 3-beta; MIP-3-beta; small inducible cytokine subfamily A (Cys-Cys), member 19; Small-inducible cytokine A19
Gene Aliases: CCL19; CKb11; ELC; MIP-3b; MIP3B; SCYA19
UniProt ID: (Human) Q99731
Entrez Gene ID: (Human) 6363
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support