Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-92006
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
KMCASQRKQSCQEESLAVQDVNMEEDSFFMESMSFKKKPKTEESIPTHKLSSLKKKCTIYGKICHFRKPPVLQTTICGAMSSIKKPTTEKETLFQELSVLQEKHTTEHEMS
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51391. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Cell proliferation is controlled at specific stages of the cell cycle by distinct protein kinase complexes. These complexes consist of a catalytic subunit associating with a specific regulatory subunit to form the active kinase. The cyclins, which include cyclin A, B, C, D, E, F, G, H, I, K, L, T and their related proteins, including Dbf4, comprise the regulatory subunits of these kinase complexes. The controlled activation of the kinase complexes at various intervals of the cell cycle is regulated by the availability of the cyclins to the catalytic subunit. Unlike the catalytic subunit, which is expressed continually, the expression and stability of the regulatory subunit fluctuates depending on the stage of the cell cycle, thereby regulating kinase activity. Cyclin B3, also known as CCNB3 or CYCB3, is a 1,395 amino acid nuclear protein that belongs to the cyclin family of regulatory proteins. Expressed in testis with lower expression in a variety of other tissues, cyclin B3 is thought to be required for early meiotic prophase I, playing an important role in the meiotic cell cycle. Three isoforms of cyclin B3 exist due to alternative splicing events.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CyclinB3; G2/mitotic-specific cyclin-B3; Protein Ccnb3
Gene Aliases: CCNB3; CYCB3
UniProt ID: (Human) Q8WWL7
Entrez Gene ID: (Human) 85417
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support