Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-106427
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWN
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Caspase-activated DNase (CAD) cleaves chromosomal DNA during apoptosis. Apoptosis which is a cell death process removing toxic and/or useless cells during mammalian development can be induced by a variety of stimuli, including the death factors of the tumor necrosis factor family, or UV irradiation, anticancer drugs, and survival factor deprivation. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. CAD, which can be activated by caspases, exists as a complex with its inhibitor, inhibitor of CAD (ICAD). ICAD helps correct folding of CAD and remains complexed with CAD to inhibit the DNase activity of CAD. Caspase, which is activated during the apoptotic process, cleaves ICAD, and the CAD released from ICAD enters the nuclei to cleave the chromosomal DNA. Internal as well as external signals can activate caspases and this is under the control of the balance between pro-and anti-apoptotic proteins of the Bcl-2 family, heat shock proteins, and inhibitors of apoptosis proteins (IAPs). Currently, fourteen members of the caspase family have been identified, of which seven mediate apoptosis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 2410008J01Rik; AU018859; CAD; Caspase-activated deoxyribonuclease; caspase-activated DNase; Caspase-activated nuclease; Cpad; CPAN; DFF-2; DFF-40; DNA fragmentation factor 40 kDa subunit; DNA fragmentation factor subunit beta; DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase); RP13-531C17.1; RP23-254N4.2
Gene Aliases: CAD; CPAN; DFF-40; DFF2; DFF40; DFFB
UniProt ID: (Human) O76075
Entrez Gene ID: (Human) 1677
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support