Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human DYNC1I2 (aa 126-174) Control Fragment Recombinant Protein
Product Details
RP-102895
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
HSDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEE
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59226. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Dyneins are multi-subunit, high molecular weight ATPases that interact with microtubules to generate force by converting the chemical energy of ATP into the mechanical energy of movement. Cytoplasmic or axonemal Dynein heavy, intermediate, light and light-intermediate chains are all components of minus end-directed motors; the complex that transports cellular cargos towards the central region of the cell. Axonemal Dynein motors contain one to three non-identical heavy chains and cause a sliding of microtubules in the axonemes of cilia and flagella in a mechanism necessary for cilia to beat and propel the cell. Cytoplasmic Dynein is an approximately 12 subunit complex of two heavy chains, two intermediate chains to anchor Dynein to its cargo, four smaller intermediate chains and several light chains. It performs functions necessary for cell survival such as organelle transport and centrosome assembly. The carboxy-terminus of Dynein is important for microtubule-dependent motility and is highly conserved, while the amino-terminal regions are more variable. Several proteins regulate Dynein activity, including Dynactin, LIS1 and nudel (nudE-like).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Cytoplasmic dynein 1 intermediate chain 2; Cytoplasmic dynein intermediate chain 2; DH IC-2; Dynein intermediate chain 2, cytosolic; dynein, cytoplasmic 1, intermediate chain 2; dynein, cytoplasmic, intermediate polypeptide 2; testis tissue sperm-binding protein Li 66n
Gene Aliases: DIC74; DNCI2; DNCIC2; DYNC1I2; IC2
UniProt ID: (Human) Q13409
Entrez Gene ID: (Human) 1781
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support