Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human E-cadherin (aa 567-691) Control Fragment Recombinant Protein
Product Details
RP-102365
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
E-Cadherin (epithelial cadherin) is a classical cadherin from the cadherin (alcium dependent adhesion protein) superfamily. The encoded protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid and ovarian cancer. Loss of function is thought to contribute to progression in cancer by increasing proliferation, invasion, and/or metastasis. The ectodomain of this protein mediates bacterial adhesion to mammalian cells and the cytoplasmic domain is required for internalization. Identified transcript variants arise from mutation at consensus splice sites. E-cadherin plays a central role in the growth and development of cells by controlling tissue architecture, and maintenance of tissue integrity. In humans, E-cadherin is encoded by the CDH1 gene present on chromosome 16. Studies have demonstrated that reduction and/or loss of E-cadherin expression in carcinomas correlates positively with the potential of these tumors for invasion and metastasis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: cadherin 1, E-cadherin (epithelial); cadherin 1, type 1; cadherin 1, type 1, E-cadherin (epithelial); cadherin e; Cadherin-1; cadherin-E; calcium-dependent adhesion protein, epithelial; CAM 120/80; CD324; cell-CAM 120/80; E-Cadherin; E-cadherin 1; Ecadherin; Epithelial cadherin; Uvomorulin
Gene Aliases: Arc-1; CD324; CDH1; CDHE; ECAD; LCAM; UVO
UniProt ID: (Human) P12830
Entrez Gene ID: (Human) 999
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support