Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-106184
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
TTIASTGQTFQITGNPVTMAGKVITKLPLPANSKIVAVNVPATQGGIVQVHQ
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83905. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
BPTF (bromodomain and PHD domain transcription factor) is the largest subunit of the ATP-dependent chromatin-remodelling complex, NURF (nucleosome remodelling factor). NURF catalyses ATP-dependent nucleosome sliding and facilitates transcription. BPTF recognises histone H3 tails that are tri-methylated at K4, which marks the transcriptional start site of the vast majority of transcriptionally active genes. BPTF also exhibits some binding to H3 di-methylated at K4. BPTF plays a key role in the development of early mouse embryos, possibly through regulation of the Smad pathway of transcription factors. While BPTF is expressed in low levels in the adult brain and spinal cord, it is expressed in higher levels in the brain in neurodegenerative diseases. It is present in a subset of amyloid-containing plaques in the brains of patients suffering from Alzheimer's disease. Abundantly expressed in the fetal brain. Present throughout the gray and white matter of the developing spinal cord at 18-22 gestational weeks. Expressed at low levels in adult brain and spinal cord and reexpressed in neurodegenerative diseases (at protein level).Tissue specificity: Ubiquitously expressed, with highest levels in testis. Present in kidney, liver and brain. In the brain, highest levels are found in motor cortex (at protein level).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: bromodomain and PHD domain transcription factor; Bromodomain and PHD finger-containing transcription factor; Fetal Alz-50 clone 1 protein; fetal Alz-50 reactive clone 1; Fetal Alzheimer antigen; nucleosome remodeling factor, large subunit; Nucleosome-remodeling factor subunit BPTF
Gene Aliases: BPTF; FAC1; FALZ; NURF301
UniProt ID: (Human) Q12830
Entrez Gene ID: (Human) 2186
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support