Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-89876
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52804. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Fibroblast growth factor 4 (FGF4) is a member of the fibroblast growth factor (FGF) family that possess broad mitogenic and cell survival activities and play key roles in growth and survival of stem cells during embryogenesis, tissue regeneration, and carcinogenesis. FGF4 was identified by its strong oncogenic transforming activity and is a potent angiogenic factor, expressed in several highly vascularized tumors and also in adult mouse testis, intestine, and brain. Studies on the mouse homolog suggests a function in bone morphogenesis and limb development through the sonic hedgehog (SHH) signaling pathway. Furthermore, FGF4 regulates neural progenitor cell proliferation and neuronal differentiation. Recent studies show a growth-promoting role for FGF4 in human embryonic stem cells and a putative feedback inhibition mechanism by a novel FGF4 splice isoform that may serve to promote differentiation at a later stages of development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: FGF; FGF-4; Fibroblast growth factor; Fibroblast growth factor 4; fibroblast growth factor 4 splice isoform; HBGF-4; heparin secretory transforming protein 1; Heparin secretory-transforming protein 1; Heparin-binding growth factor 4; HST; HSTF-1; human stomach cancer, transforming factor from FGF-related oncogene; kaposi sarcoma oncogene; oncogene HST; Transforming protein KS3
Gene Aliases: FGF4; HBGF-4; HST; HST-1; HSTF1; K-FGF; KFGF; KS3
UniProt ID: (Human) P08620
Entrez Gene ID: (Human) 2249
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support