Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human FKBP15 (aa 542-663) Control Fragment Recombinant Protein
Product Details
RP-89625
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
KHSAGNSMLIPSMSVTMETSMIMSNIQRIIQENERLKQEILEKSNRIEEQNDKISELIERNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEQEKAKVTEELAAATAQVSHLQLKMTAHQ
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52495. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
FKBP15, also known as FKBP133, is a member of the FK506-binding protein family, a group of proteins initially identified as immunophilins, targets for the immunosupressant drugs FK506 and Rapamycin. FKBP15 is expressed in the developing nervous system and contains a domain similar to Wiskott-Aldrich syndrome protein homology region 1 (WH1) in addition to the FK506-binding protein motif. FKBP15 is distributed along the axonal shafts and partially co-localizes with F-actin in the growth cones of dorsal root ganglion neurons; overexpression of FKBP15 resulted in the number of filopodia in transfected neurons, suggesting that FKBP15 modulates growth cone behavior. FKBP15 has also been shown to associate with both microtubules and the actin filament systems and disruption of its expression by RNAi resulted in delayed transport of early endosomes in HeLa cells indicating that FKBP15 is also involved in the transport of early endosomes. At least three isoforms of FKBP15 are known to exist.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 133 kDa FK506-binding protein; 133 kDa FKBP; FK506 binding protein 15, 133kDa; FK506-binding protein 133kDa; FK506-binding protein 15; FKBP-133; FKBP-15; protein phosphatase 1, regulatory subunit 76; WAFL; WASP and FKBP-like protein; WASP- and FKBP-like protein
Gene Aliases: FKBP133; FKBP15; KIAA0674; PPP1R76
UniProt ID: (Human) Q5T1M5
Entrez Gene ID: (Human) 23307
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support