Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-96499
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
YRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQ
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (33%), Rat (33%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58200. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Eukaryotic Histones are basic and water soluble nuclear proteins that form hetero-octameric nucleosome particles by wrapping 146 base pairs of DNA in a left-handed super-helical turn sequentially to form chromosomal fibers. Two molecules of each of the four core Histones (Histone H2A, H2B, H3, and H4) form the octamer, which consists of two H2A-H2B dimers and two H3-H4 dimers that are nearly symmetrical by tertiary structure. Over 80% of nucleosomes contain the linker Histone H1, derived from an intronless gene, that interacts with linker DNA between nucleosomes and mediates compaction into higher order chromatin. H1FOO (H1 histone family, member O, oocyte-specific), also known as OSH1, is a 346 amino acid oocyte-specific Histone that localizes to both the nucleus and the cytoplasm. Expressed as multiple alternatively spliced isoforms, H1FOO is thought to play an important role in gene control during oogenesis and early embryogenesis and is crucial for meiotic maturation of germinal vesicle-stage oocytes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: H1 histone family, member O, oocyte-specific; Histone H1.8; Histone H1oo; Oocyte-specific histone H1; Oocyte-specific linker histone H1; osH1
Gene Aliases: H1-8; H1.8; H1FOO; H1OO; OSH1
UniProt ID: (Human) Q8IZA3
Entrez Gene ID: (Human) 132243
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support