Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human LATS2 (aa 132-248) Control Fragment Recombinant Protein
Product Details
RP-106215
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
ALEYISKMGYLDPRNEQIVRVIKQTSPGKGLMPTPVTRRPSFEGTGDSFASYHQLSGTPYEGPSFGADGPTALEEMPRPYVDYLFPGVGPHGPGHQHQHPPKGYGASVEAAGAHFPL
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83944. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
LATS2 is a serine/threonine protein kinase belonging to the LATS tumor suppressor family. LATS2 interacts with a negative regulator of p53 and function in a positive feedback loop with p53 that responds to cytoskeleton damage and this interaction provokes centrosome/mitotic apparatus dysfunction. LATS2 plays an essential role in the maintenance of mitotic fidelity and genomic integrity. LATS2 plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. It negatively regulates G1/S transition by down-regulating cyclin E/CDK2 kinase activity.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Kinase phosphorylated during mitosis protein; Large tumor suppressor homolog 2; LATS (large tumor suppressor, Drosophila) homolog 2; LATS, large tumor suppressor, homolog 2; LATS2; serine/threonine kinase KPM; Serine/threonine-protein kinase kpm; Serine/threonine-protein kinase LATS2; Warts-like kinase
Gene Aliases: KPM; LATS2
UniProt ID: (Human) Q9NRM7
Entrez Gene ID: (Human) 26524
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support