Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human NALCN (aa 204-265) Control Fragment Recombinant Protein
Product Details
RP-95697
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
TYHCVVNDTKPGNVTWNSLAIPDTHCSPELEEGYQCPPGFKCMDLEDLGLSRQELGYSGFNE
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56887. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Nalcn is a voltage-independent, cation-nonselective channel which is permeable to sodium, potassium and calcium ions. Nalcn regulates the resting membrane potential and controls neuronal excitability (PubMed:17448995). Neuropeptides such as neurotensin and substance P (SP) stimulate the firing of action potentials by activating NALCN through a SRC family kinases-dependent pathway. In addition to its baseline activity, Nalcn activity is enhanced/modulated by several GPCRs, is required for normal respiratory rhythm and neonatal survival, is involved in systemic osmoregulation by controlling the serum sodium concentration. Nalcn is partly responsible for the substance P-induced depolarization and regulation of the intestinal pace-making activity in the interstitial cells of Cajal. Further, Nalcn plays a critical role in both maintenance of spontaneous firing of substantia nigra pars reticulata (SNr) neurons and physiological modulation of SNr neuron excitability. Diseases associated with NALCN include Congenital contractures of the limbs and face, Hypotonia, Developmental Delay and Hypotonia, Infantile Psychomotor Retardation And Characteristic Facies 1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CanIon; FLJ23913; FLJ44659; FLJ44764; four repeat voltage-gated ion channel; MGC74524; Sodium leak channel NALCN; Sodium leak channel non-selective protein; sodium leak channel, non selective; voltage gated channel like 1; Voltage gated channel-like protein 1
Gene Aliases: bA430M15.1; CanIon; CLIFAHDD; IHPRF; IHPRF1; INNFD; NALCN; VGCNL1
UniProt ID: (Human) Q8IZF0
Entrez Gene ID: (Human) 259232
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support