Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-92074
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
EVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVI
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (26%), Rat (26%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82734. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
NALP2 belongs to a family of cytoplasmic proteins that have been implicated in cell responses to apoptotic and inflammatory stimuli. Unlike the prototypical NALP protein NALP1, NALP2 only contains a NACHT domain, leucine rich repeat (LRR), and pyrin-containing domain (PYD). This protein interacts with the adapter protein ASC in addition to CARD8 and caspase-1 to form an inflammasome with high proIL-1-b-processing activity and is thought to function as a modulator of NF-kappa-B and procaspase-1 activation in macrophages. It has also been suggested that NALP2, in addition to other NALP family members, can act as innate sensors of pathogens in a manner similar to the toll-like receptors (TLRs). At least two alternatively spliced transcript variants encoding distinct isoforms have been found for NALP2.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: FLJ20510; NACHT, leucine rich repeat and PYD containing 2; NACHT, LRR and PYD containing protein 2; NACHT, LRR and PYD domains-containing protein 2; NLR family, pyrin domain containing 2; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 2; Nucleotide-binding site protein 1; PYRIN domain and NACHT domain-containing protein 1; PYRIN-containing APAF1-like protein 2
Gene Aliases: CLR19.9; NALP2; NBS1; NLRP2; PAN1; PYPAF2
UniProt ID: (Human) Q9NX02
Entrez Gene ID: (Human) 55655
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support