Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human NFkB p52/p100 (aa 82-216) Control Fragment Recombinant Protein
Product Details
RP-102343
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
ICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQP
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82852. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The NFkB transcription factor was originally identified as a protein complex consisting of a DNA binding subunit and an associated protein. The subunit is functionally related to c-Rel p75 and Rel B p68. The p50 subunit was initially believed to be a functionally unique protein derived from the amino-terminus of a precursor designated p105. A cDNA has been isolated that encodes an alternative DNA binding subunit of NFkB. It is synthesized as a protein that is expressed in a variety of cell types and, like p105, undergoes cleavage to generate its NFkB subunit, in this case a protein designated p52 (previously referred to as p49). In contrast to p50 derived from p105, p52 acts in synergy with p65 to stimulate the HIV enhancer in transiently transfected Jurkat cells.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: DNA-binding factor KBF2; H2TF1; Lymphocyte translocation chromosome 10 protein; Lyt10; NF KB; NF-kB p52/p100; nfkb p100; NFKB, p52/p100 subunit; nuclear factor; nuclear factor kappa b; nuclear factor Kappa-B, subunit 2; Nuclear factor NF-kappa-B p100 subunit; nuclear factor NF-kappa-B p52 subunit; nuclear factor of Kappa light chain gene enhancer in B cells 2; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2; nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100); Oncogene Lyt-10; transcription factor NFKB2
Gene Aliases: CVID10; H2TF1; LYT-10; LYT10; NF-kB2; NFKB2; p100; p49/p100; p52
UniProt ID: (Human) Q00653
Entrez Gene ID: (Human) 4791
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support