Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-109691
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
VPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQT
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139965. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Steroidogenic factor-1 (SF-1) is an orphan nuclear receptor involved in organ development and differentiation of the endocrine system. SF-1 has been shown to be essential for fetal development of the hypothalamus, pituitary gland, gonads, and the adrenal gland. SF-1 has been shown to promote transcriptional activity of many steroidogenic enzymes from the cytochrome P450 family. SF-1 contains two activation function domains, designated AF1 and AF2, common to many nuclear steroid receptors which have been shown to be necessary for interaction with other nuclear receptors as well as coactivators and corepressors including steroid receptor coactivator-1 (SRC-1), glucocorticoid receptor interacting protein 1 (GRIP1), cAMP response element binding protein (CREB) binding protein (CBP) and silencing mediator of retinoid acid and thyroid hormone receptor (SMRT).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: adrenal 4 binding protein; Adrenal 4 binding protein (AD4BP); Adrenal 4-binding protein; Fushi tarazu factor homolog 1; Fushi tarazu factor homolog 1 (FTZ1); nuclear receptor AdBP4; Nuclear receptor subfamily 5 group A member 1; Nuclear receptor subfamily 5 group A member 1 (NR5A1); nuclear receptor subfamily 5, group A, member 1; SF-1; Steroid hormone receptor Ad4BP; Steroidogenic factor 1; Steroidogenic factor 1 (SF1); steroidogenic factor 1 nuclear receptor; steroidogenic factor-1; STF-1; STF1
Gene Aliases: AD4BP; ELP; FTZ1; FTZF1; hSF-1; NR5A1; POF7; SF-1; SF1; SPGF8; SRXY3
UniProt ID: (Human) Q13285
Entrez Gene ID: (Human) 2516
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support