Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-109505
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
SNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Fox-3, also known as NEUN, HRNBP3, RBFOX3 (RNA binding protein, fox-1) or Fox-1 homolog C, is a 350 amino acid protein that contains one RRM (RNA recognition motif) domain. Localized to both the nucleus and cytoplasm, Fox-3 is suggested to regulate alternative splicing events. Fox-3 is encoded by a gene located on human chromosome 17, which is comprised over 2.5% of the human genome and encodes over 1,200 genes. Two key tumor suppressor genes are associated with chromosome 17, namely, p53 and BRCA1. Tumor suppressor p53 is necessary for maintenance of cellular genetic integrity by moderating cell fate through DNA repair versus cell death. Malfunction or loss of p53 expression is associated with malignant cell growth and LiFraumeni syndrome. Like p53, BRCA1 is directly involved in DNA repair, though specifically it is recognized as a genetic determinant of early onset breast cancer and predisposition to cancers of the ovary, colon, prostate gland and fallopian tubes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: FLJ56884; FLJ58356; fox 1 homolog (C. elegans) 3; Fox-1 homolog C; fox1 homolog C; FOX3NeuN; hexaribonucleotide binding protein 3; hexaribonucleotide binding protein 3 (HRNBP3); NeuN antigen; neuronal nuclei; Neuronal nuclei antigen; RFOX3; RNA binding protein; RNA binding protein fox-1 homolog 3; RNA binding protein, fox-1 homolog (C. elegans) 3
Gene Aliases: FOX-3; FOX3; HRNBP3; NEUN; RBFOX3
UniProt ID: (Human) A6NFN3
Entrez Gene ID: (Human) 146713
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support