Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human PAGR1 (aa 163-252) Control Fragment Recombinant Protein
Product Details
RP-98795
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
HMPTEFDFDDEPVTPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKRHKKLEEQILRTGRDLFSLDSEDPSPASPPLRSSGSSLFPRQR
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60436. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Steroid receptor co-activators (SRCs) were initially described as nuclear receptor transcription co-activators, but they have recently been determined to co-regulate transcription initiated by other transcription factors. GAS is a recently identified glutamate-rich protein that interacts with SRC1, but not GRIP1 or AIB1, the other two members of the SRC family. GAS can also interact with the alpha subunit of the estrogen receptor (ERalpha), but not other receptors such as the retinoic acid receptor a, suggesting the interaction between GAS and ERalpha is relatively specific. Depletion of GAS by RNA interference in MCF7 cells led to a decrease in the mRNA and protein levels of ER target genes such as pS2, c-Myc and cyclin D1, indicating the role of GAS in the regulation of ER target genes. GAS has also been found to associate with an SET1-like methyltransferase complex specific for H3K4 methylation, suggesting that GAS has multiple roles in transcriptional regulation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: GAS; glutamate-rich coactivator associated with SRC1; Glutamate-rich coactivator interacting with SRC1; glutamate-rich coactivator interacting with SRC1/NCOA1; PAXIP1 associated glutamate-rich protein 1; PAXIP1-associated glutamate-rich protein 1; PAXIP1-associated protein 1; PTIP-associated 1 protein; PTIP-associated protein 1
Gene Aliases: C16orf53; GAS; PA1; PAGR1
UniProt ID: (Human) Q9BTK6
Entrez Gene ID: (Human) 79447
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support