Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human PDGF-D (aa 121-193) Control Fragment Recombinant Protein
Product Details
RP-106112
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASETNWESVTSSISGV
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (%), Rat (%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The platelet-derived growth factor (PDGF) family consists of four members; PDGF-A, PDGF-B, PDGF-C and PDGF-D (spinal cord-derived growth factor-B or iris-expressed growth factor). PDGF members form disulphide-bonded dimeric isoforms, which are important for growth, survival and function in several types of connective tissue cells. Their biological effects are mediated via two tyrosine kinase receptors, PDGFR-a and PDGFR-b, and PDGF-mediated signaling is critical for development of many organ systems. PDGF-D has a two-domain structure similar to PDGF-C and is secreted as a disulphide-linked homodimer, PDGF-DD. PDGF-D induces cellular transformation and promotes tumor growth by accelerating the proliferation rate of tumor cells and by stimulation of tumor neovascularization. PDGF-D may play a role in the development of brain tumors. The potential oncogenic activity of PDGF-DD may be important for the development and/or progression of prostate cancer. PDGF-D is expressed in fibroblastic adventitial cells, cultured endothelial cells and in a variety of tumor cell lines including those derived from ovarian, renal and lung cancers, as well as from astrocytomas and medulloblastomas. PDGF-D is expressed in the human kidney.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Iris-expressed growth factor; PDGF-D; Platelet-derived growth factor D; SCDGF-B; spinal cord derived growth factor B; Spinal cord-derived growth factor B; spinal cord-derived growth factor-B
Gene Aliases: IEGF; MSTP036; PDGFD; SCDGF-B; SCDGFB; UNQ1899/PRO4345
UniProt ID: (Human) Q9GZP0
Entrez Gene ID: (Human) 80310
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support