Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-101083
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
MKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMYGHENGNSSSPSPEEKGE
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84179. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Voltage-gated sodium channels are selective ion channels that regulate the permeability of sodium ions in excitable cells. During the propagation of an action potential, sodium channels allow an influx of sodium ions, which rapidly depolarize the cell. The three glycoproteins that comprise the voltagegated sodium channel proteins include a pore-forming alpha subunit, a noncovalently associated beta1 subunit and a disulfide-linked beta2 subunit. The two beta subunits regulate the level of channel expression, modulate gating and function as cell adhesion molecules for cellular aggregation and cytoskeleton interaction. The alpha subunits of sodium channels type I and III are predominantly expressed in neuronal cell bodies and proximal processes, while type II alpha subunits are more abundant along axons. The beta1 subunit of sodium channel type I is expressed in brain, skeletal and cardiac muscle. In the brain, beta1 and beta2 are highly expressed in Purkinje cells, and beta1 is also expressed in the pyramidal cells of the deep cerebellar nuclei. Impaired voltage-gated sodium channels lead to a number of diseases including myotonia.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CTC-264K15.6; KIAA1356; MED; NAC1; NAC2; NAC3; Nav1.1; Nav1.2; Nav1.3; Nav1.5; Nav1.6; Nav1.7; Nav1.8; Nav1.9; NENA; SCN1; SCN10A; SCN11A; SCN12A; SCN1A; SCN2A; SCN2A1; SCN2A2; SCN3A; SCN5A; SCN8A; SCN9A; skeletal muscle sodium channel alpha subunit; skeletal muscle voltage-dependent sodium channel type IV alpha subunit; SkM1; SNS2; Sodium channel protein skeletal muscle subunit alpha; Sodium channel protein type 4 subunit alpha; Sodium channel protein type IV subunit alpha; sodium channel, voltage gated, type IV alpha subunit; sodium channel, voltage-gated, type IV, alpha subunit; Voltage-gated sodium channel subunit alpha Nav1.4
Gene Aliases: CMS16; HOKPP2; HYKPP; HYPP; Na(V)1.4; NAC1A; Nav1.4; SCN4A; SkM1
UniProt ID: (Human) P35499
Entrez Gene ID: (Human) 6329
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support