Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-109036
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
HKCVRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGTS
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Scn5a is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. Scn5a is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram. Defects in Scn5a are a cause of long QT syndrome type 3 (LQT3), an autosomal dominant cardiac disease. Alternative splicing results in several transcript variants encoding different isoforms of Scn5a. Voltage-gated sodium channesl (VGSCs) mediate regenerative cell membrane depolarization and conduction of electrical signalling in nerves and muscles. Expression of Scn5a is also detected in lymphocytes, glia, and fibroblasts. Further, Scn5a mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, Scn5a forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. Functionally, Scn5a is responsible for the initial upstroke of the action potential and the channel inactivation is regulated by intracellular calcium levels. Voltage-gated sodium channels (NaV) are responsible for action potential initiation and propagation in excitable cells, including nerve, muscle, and neuroendocrine cell types. Scn5a are also expressed at low levels in non-excitable cells, where their physiological role is unclear. Diseases associated with SCN5A include Long Qt Syndrome-3 and Brugada Syndrome 1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: cardiac tetrodotoxin-insensitive voltage-dependent sodium channel alpha subunit; CDCD2VF1; CIN5; hH1; HH1CMD1E; LQT3SSS1CMPD2; RATRSKM2X; RH1; RSkM2; RSKM2X; Scn2x; Sodium channel protein cardiac muscle subunit alpha; Sodium channel protein type 5 subunit alpha; Sodium channel protein type V subunit alpha; sodium channel, voltage gated, type V alpha subunit; sodium channel, voltage-gated, type V, alpha subunit; Voltage-gated sodium channel subunit alpha Nav1.5
Gene Aliases: CDCD2; CMD1E; CMPD2; HB1; HB2; HBBD; HH1; ICCD; IVF; LQT3; Nav1.5; PFHB1; SCN5A; SSS1; VF1
UniProt ID: (Human) Q14524
Entrez Gene ID: (Human) 6331
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support