Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human SCN8A (aa 1894-1950) Control Fragment Recombinant Protein
Product Details
RP-109360
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
QEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSV
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The sodium channel protein type 8 subunit alpha (Na+ CP type VIII alpha ) is a multi-pass, transmembrane protein that mediates the sodium ion permeability of excitable membranes. The three glycoproteins that comprise the voltage-gated sodium channel proteins include a pore-forming alpha subunit, a noncovalently associated beta1 subunit and a disulfide-linked beta2 subunit. The two beta subunits regulate the level of channel expression, modulate gating and function as cell adhesion molecules for cellular aggregation and cytoskeleton interaction. The alpha subunits of sodium channels type I and III are predominantly expressed in neuronal cell bodies and proximal processes, while type II alpha subunits are more abundant along axons. Sodium channels are important for rapid signal transduction but also play a significant role in neuronal development. Defects of the SCN8A gene have exhibited detrimental effects on the growth of secondary motoneurons. Loss of SCN8A expression will result in progressive paralysis and early death.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: hNa6/Scn8a voltage-gated sodium channel; Scn8a (PN4); Sodium channel protein type 8 subunit alpha; Sodium channel protein type VIII subunit alpha; sodium channel, voltage gated, type VIII alpha subunit; sodium channel, voltage gated, type VIII, alpha subunit; Voltage-gated sodium channel subunit alpha Nav1.6; voltage-gated sodium channel type VIII alpha protein
Gene Aliases: CERIII; CIAT; EIEE13; MED; NaCh6; Nav1.6; PN4; SCN8A
UniProt ID: (Human) Q9UQD0
Entrez Gene ID: (Human) 6334
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support