Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-107861
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
EHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHY
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111688. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Reversible phosphorylation of tyrosine residues is a key regulatory mechanism for numerous cellular events such as proliferation, differentiation, gene expression and migration. Abnormalities in tyrosine phosphorylation play a role in the pathogenesis of numerous inherited or acquired human diseases from cancer to immune deficiencies. There are at least 107 genes coding for PTPs (protein tyrosine phosphatases) in the human genome. All known PTPs contain a highly conserved 12 amino acid catalytic domain and are further distinguished on the basis of additional structural motifs. The receptor-like PTPs exhibit an extracellular domain, a single transmembrane and one or two intracellular phosphatase domains. The nonreceptor cytoplasmic PTPs contain a single phosphatase domain and additional amino acid sequences that are homologous to motifs found in other classes of proteins. Protein tyrosine phosphatases PTPN5 (STEP), PTPRR and PTPN7 comprise a family of phosphatases that specifically inactivate MAPKs (mitogen-activated protein kinases). There are multiple forms of STEP in the adult rat brain which show differential enrichment in brain regions implicated in aspects of cognitive, affective, and motor behaviors. Some of the STEP isoforms are generated through alternative splicing of a single STEP gene and each has unique intracellular targets and functions.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: FLJ14427; Neural-specific protein-tyrosine phosphatase; protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched); protein-tyrosine phosphatase striatum-enriched; PTN5; PTP STEP; PTPN 5; STEP; striatal-enriched protein tyrosine phosphatase; Striatum-enriched protein-tyrosine phosphatase; Tyrosine-protein phosphatase non-receptor type 5
Gene Aliases: PTPN5; PTPSTEP; STEP; STEP61
UniProt ID: (Human) P54829
Entrez Gene ID: (Human) 84867
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support