Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-89786
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
NLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQSESGRLS
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
TAK1 (also known as MAP3K7), a part of the serine/threonine kinase family, is a versatile protein with many signaling functions. Originally identified as a TGF- beta-activated kinase, TAK1 interacts with TGF- beta-receptor and TRAF6 to modulate TGF- beta activation of JNK and p38. It has additional roles in activation of p38 and JNK through Wnt, BMP, and activin signaling pathways as well in response to thyroid hormone, osmotic stress, endothelin, and ephrine. Through activation of von Hippel-Lindau tumor suppressor expression, TAK1 represses PDGF-B, integrin beta1 and integrin beta5, promoting proper wound healing. TAK1 also plays an essential role in IKK activation in numerous signaling pathways including IL-1, IL-6, IL-18, TNF, CD40, TLR, and RIG-I. Activation of the TAK1-IKK pathway requires TAB2/3 and ubiquitination. In this process, TAB2/3 binds to the C-terminal region of TAK1 and becomes polyubiquitinated, TAK1 is autophosphorylated at Thr178, Thr184, Thr187 and Ser192, and finally TAK1 phosphorylates IKK- beta. Additionally, TAK1 represses human telomerase reverse transcriptase suggesting a role in regulation of cell lifespan.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: M3K7; Mitogen-activated protein kinase kinase kinase 7; RP1-154G14.1; TGF-beta activated kinase 1; TGF-beta-activated kinase 1; Transforming growth factor-beta-activated kinase 1
Gene Aliases: MAP3K7; MEKK7; TAK1; TGF1a
UniProt ID: (Human) O43318
Entrez Gene ID: (Human) 6885
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support