Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human TGF beta-1 (aa 194-277) Control Fragment Recombinant Protein
Product Details
RP-109343
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
EWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHR
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
TGF beta-1 (TGFB1, Transforming Growth Factor Beta 1) is a polypeptide member of the transforming growth factor beta superfamily of cytokines, found almost ubiquitously in tissues. Transforming growth factor (TGF)-b is stored in the extracellular matrix as a latent complex with its pro-domain. Activation of TGF beta-1 requires the binding of aV integrin to an RGD sequence in the prodomain and exertion of force on this domain, which is held in the extracellular matrix by latent TGF-b binding proteins. Latent forms are complexes of TGF beta-1, an amino-terminal portion of the TGF-beta precursor, designated TGF-LAP (TGF-latency associated peptide), and a specific binding protein, known as LTBP. TGF beta-1 helps regulates proliferation, differentiation, adhesion, migration in many cell types. Many cells have TGF beta receptors, and the protein positively and negatively regulates many other growth factors. TGF beta-1 is cleaved into a latency-associated peptide and a mature TGF beta-1 peptide, and is found in either a latent form composed of a TGFB1 homodimer, a LAP homodimer, and a latent TGFB1-binding protein, or in an active form composed of a TGF beta-1 homodimer. The mature peptide may also form heterodimers with other TGF beta family members. The gene for TGF beta-1 is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease and cystic fibrosis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: latency-associated peptide; prepro-transforming growth factor beta-1; TGF b; TGF b 1; TGF beta; tgf beta 1; TGF beta-1; TGF beta-1 protein; tgf beta1; TGF β; TGF β 1; TGF β1; TGF-B1; TGF-beta 1 protein; TGF-beta-1; TGFβ1; Transforming growth factor; transforming growth factor b1; transforming growth factor beta; Transforming growth factor beta-1 proprotein; transforming growth factor β1
Gene Aliases: CED; DPD1; LAP; TGFB; TGFB1; TGFbeta
UniProt ID: (Human) P01137
Entrez Gene ID: (Human) 7040
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support