Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human UFD1L (aa 111-196) Control Fragment Recombinant Protein
Product Details
RP-95339
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
QVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLG
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56427. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Ubiquitin-mediated proteolysis requires the transfer of ubiquitin (Ub) to lysine groups on selected cellular proteins, which then potentiates the proteolytic degradation of these protein conjugates by the 26S proteasome. Ub-fusions are cleaved by Ub-specific processing proteases (UBps) or alternatively by the Ub-fusion degradation (UFD) pathway. The UBP pathway targets the C-terminal glycine residue on Ub that is involved in the formation of Ub-conjugates, while UFD proteins preferentially cleave Ub-conjugated proteins that contain an amino acid substitution at this glycine residue. The UFD1 protein was originally characterized in the yeast S. cerevisiae and subsequently, the human homolog UFD1 or UFD1L was identified. In vitro, UFD1 attenuates the degradation of Ub-fusions, which have a proline or valine residue substituted at the Gly76 moiety, by the selective multiubiquitination of the Ub chain of the Ub-conjugate. Mutations within the UFD1 gene are implicated in the development of CATCH22 syndrome, which is characterized by cardiac defects, cleft palate and hypocalcemia, suggesting that this proteolytic pathway may be involved in the progression of these developmental defects.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: UB fusion protein 1; Ubiquitin fusion degradation protein 1; Ubiquitin recognition factor in ER-associated degradation protein 1
Gene Aliases: UFD1; UFD1L
UniProt ID: (Human) Q92890
Entrez Gene ID: (Human) 7353
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support