Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-109776
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
GESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGL
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The human UNG gene encodes both nuclear (UNG2) and mitochondrial (UNG1) forms of uracil-DNA glycosylase. These forms are generated by alternative splicing and the use of two differentially regulated promoters, PA and PB. The cDNAs for UNG1 and UNG2 are of similar size (2061 and 2058 bp, respectively) and as a result the corresponding mRNAs are not resolved as two species in gel electrophoresis. Nuclear UNG2 differs from mitochondrial UNG1 in 44 amino acids of the N-terminal sequence that is not necessary for catalytic activity. A major role of the UNG gene products is to repair mutagenic U:G mispairs caused by cytosine deamination. For example, UNG2 removes misincorporated dUMP residues. The level and expression pattern of UNG1 and UNG2 differs between cell and tissue type. Additionally, the expression of UNG is cell cycle regulated. The expression and activity of UNG has been found in general to be higher in proliferating as compared to nonproliferating tissues and cells. UNG1 is a 304 amino acid protein. UNG2 is a 313 amino acid protein.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: DKFZp781L1143; UDG; UNG; Uracil-DNA glycosylase; uracil-DNA glycosylase 1, uracil-DNA glycosylase 2
Gene Aliases: DGU; HIGM4; HIGM5; UDG; UNG; UNG1; UNG15; UNG2
UniProt ID: (Human) P13051
Entrez Gene ID: (Human) 7374
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support